PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s923801g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family TALE
Protein Properties Length: 528aa    MW: 58510.9 Da    PI: 7.0245
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s923801g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox15.52.9e-053343621945
                        HHH..SSS--HHHHHHHHHHCTS-HHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVk 45 
                        Fe   ++yps +++++LA+++gL+ +q+ 
  PDK_30s923801g001 334 FEHflHPYPSDADKQQLARQTGLSRNQID 362
                        664559*********************96 PP

2BELL93.42.1e-302072651472
               BELL  14 slleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +lleeVdkrY++y++q+q+v++sF+ v+g g+a+pY+ l  ka+SrhFrc+kdai++q+
  PDK_30s923801g001 207 ELLEEVDKRYNHYCNQMQMVVNSFDSVMGFGAATPYIGLGHKAMSRHFRCIKDAISKQL 265
                        69*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.7E-15128263IPR006563POX domain
PfamPF075262.3E-26207262IPR006563POX domain
SuperFamilySSF466891.8E-8308362IPR009057Homeodomain-like
PROSITE profilePS500718.892312399IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.2E-26314412IPR009057Homeodomain-like
CDDcd000861.26E-9315400No hitNo description
SMARTSM003891.8E-5315403IPR001356Homeobox domain
PfamPF059201.3E-16332395IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MARFFGRQGR LLLVVNVVNR NKGHYQGITT CQEHQMDHIA QQSRRDKLRV QGFEATTLHP  60
LDQIEDKRLD LGAYEHTRTG NILSDMFNFP APGLASQISG IDRLPPRPVP EFSGEWYGDN  120
RQGVVMGSNF SSLGDTAADS ATVQLLLMNM PSHEPHPRST TFGDGSFSGG VVENRGLSLS  180
LSSSLHELEM GGVSVVRNSS FVRAATELLE EVDKRYNHYC NQMQMVVNSF DSVMGFGAAT  240
PYIGLGHKAM SRHFRCIKDA ISKQLKQVHE LLGEKEEGST SGITKGETPR LRLLEQSLRQ  300
RRPYHQIGMI ESEAWRPQRG LPERSVNILR AWLFEHFLHP YPSDADKQQL ARQTGLSRNQ  360
IDIKIILFGT IDGFLPRTPY TFFLVSNWFI NARVRLWKPM VEEIYQQEAK EKVATRREDK  420
KDGQGVRPQS PPQNNSPQGQ GPEANLTDSP AAAAAHQSND DAILIGTDTP ASAMDLCGAD  480
MEPMDDLCGT AAATALGSGV RLGAAGDVSL TLGLRHSGNS SEKHWFYG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008797003.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL56e-97BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A067KJ171e-107A0A067KJ17_JATCU; Uncharacterized protein
STRINGGSMUA_Achr4P14670_0011e-105(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.34e-86BEL1-like homeodomain 4